CCDC90A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91586

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human CCDC90A. Peptide sequence ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CCDC90A Antibody - BSA Free

Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586] - Host: Rabbit. Target Name: MCUR1. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane
Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586] - OVCAR-3 Cell lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586]

Western Blot: CCDC90A Antibody [NBP1-91586] - Host: Rabbit. Target Name: CCDC90A. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 3ug/ml

Applications for CCDC90A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCDC90A

Alternate Names

C6orf79, coiled-coil domain containing 90A, coiled-coil domain-containing protein 90A, mitochondrial, FLJ20958, fmp32, MCUR1, mitochondrial calcium uniporter regulator 1

Gene Symbol

CCDC90A

Additional CCDC90A Products

Product Documents for CCDC90A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCDC90A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCDC90A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCDC90A Antibody - BSA Free and earn rewards!

Have you used CCDC90A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...