CCL3L1/LD78 beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05563

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CCL3L1/LD78 beta Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1/LD78 beta (NP_066286.1). APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CCL3L1/LD78 beta Antibody - BSA Free

Western Blot: CCL3L1/LD78 beta AntibodyBSA Free [NBP3-05563]

Western Blot: CCL3L1/LD78 beta AntibodyBSA Free [NBP3-05563]

Western Blot: CCL3L1/LD78 beta Antibody [NBP3-05563] - Western blot analysis of extracts of B-cell cells, using CCL3L1/LD78 beta antibody (NBP3-05563) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 60s.

Applications for CCL3L1/LD78 beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CCL3L1/LD78 beta

Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988). Sherry et al. (1988) demonstrated 2 protein components of MIP1, called by them alpha and beta.

Alternate Names

C-C motif chemokine 3-like 1, CCL3L3, chemokine (C-C motif) ligand 3-like 1, D17S1718, G0/G1 switch regulatory protein 19-2, G0S19-2LD78, LD78BETA, LD78-beta(1-70), MGC104178, MGC12815, MGC182017, MIP1AP, PAT 464.2, SCYA3L, SCYA3L1464.2, small inducible cytokine A3-like 1, Small-inducible cytokine A3-like 1, Tonsillar lymphocyte LD78 beta protein

Gene Symbol

CCL3L1

Additional CCL3L1/LD78 beta Products

Product Documents for CCL3L1/LD78 beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCL3L1/LD78 beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCL3L1/LD78 beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCL3L1/LD78 beta Antibody - BSA Free and earn rewards!

Have you used CCL3L1/LD78 beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies