CCNB1IP1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92337

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all CCNB1IP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1). MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CCNB1IP1 Antibody - Azide and BSA Free

Western Blot: CCNB1IP1 AntibodyAzide and BSA Free [NBP2-92337]

Western Blot: CCNB1IP1 AntibodyAzide and BSA Free [NBP2-92337]

Western Blot: CCNB1IP1 Antibody [NBP2-92337] - Analysis of extracts of mouse heart, using CCNB1IP1.Exposure time: 90s.

Applications for CCNB1IP1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CCNB1IP1

HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM]

Alternate Names

chromosome 14 open reading frame 18, cyclin B1 interacting protein 1, cyclin B1 interacting protein 1, E3 ubiquitin protein ligase, E3 ubiquitin-protein ligase CCNB1IP1, EC 6.3.2.-, enhancer of invasion 10, HEI10C14orf18Cyclin-B1-interacting protein 1, Human enhancer of invasion 10

Gene Symbol

CCNB1IP1

Additional CCNB1IP1 Products

Product Documents for CCNB1IP1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCNB1IP1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for CCNB1IP1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CCNB1IP1 Antibody - Azide and BSA Free and earn rewards!

Have you used CCNB1IP1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies