CCT6A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87159

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CCT6A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TCPZ. Peptide sequence: HAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CCT6A Antibody - BSA Free

Western Blot: CCT6A Antibody [NBP2-87159]

Western Blot: CCT6A Antibody [NBP2-87159]

Western Blot: CCT6A Antibody [NBP2-87159] - Host: Rabbit. Target Name: TCPZ. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for CCT6A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCT6A

The CCT6A gene encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known asthe TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight differentproteins. Unfolded poly

Alternate Names

acute morphine dependence related protein 2, Acute morphine dependence-related protein 2, amino acid transport defect-complementing, CCT6, CCTZ, CCT-zeta, CCT-zeta-1, chaperonin containing T-complex subunit 6, chaperonin containing TCP1, subunit 6A (zeta 1), histidine transport regulator 3, HTR3MGC126215, MGC126214, MoDP-2, T-complex protein 1 subunit zeta, T-complex protein 1, zeta subunit, TCP-1-zeta, TCP20, TCPZ, TTCP20

Gene Symbol

CCT6A

Additional CCT6A Products

Product Documents for CCT6A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCT6A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCT6A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCT6A Antibody - BSA Free and earn rewards!

Have you used CCT6A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies