CCT6B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56939

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CCT6B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CCT6B(chaperonin containing TCP1, subunit 6B (zeta 2)) The peptide sequence was selected from the N terminal of CCT6B. Peptide sequence VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: zeta-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CCT6B Antibody - BSA Free

Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 1 ug/ml

Applications for CCT6B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCT6B

CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Alternate Names

Cctz2, CCTZ-2, CCT-zeta-2, CCT-zeta-like, chaperonin containing TCP1, subunit 6B (zeta 2), T-complex protein 1 subunit zeta-2, T-complex protein 1, zeta-2 subunit, TCP-1-zeta-2, TCP-1-zeta-like, Testis-specific protein TSA303, Testis-specific Tcp20, TSA303

Gene Symbol

CCT6B

Additional CCT6B Products

Product Documents for CCT6B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCT6B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCT6B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCT6B Antibody - BSA Free and earn rewards!

Have you used CCT6B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies