CCT8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56608

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CCT8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: theta.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CCT8 Antibody - BSA Free

Western Blot: CCT8 Antibody [NBP1-56608]

Western Blot: CCT8 Antibody [NBP1-56608]

Western Blot: CCT8 Antibody [NBP1-56608] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: CCT8 Antibody [NBP1-56608]

Western Blot: CCT8 Antibody [NBP1-56608]

Western Blot: CCT8 Antibody [NBP1-56608] - Sample Type: HEK 293 (10ug) Primary Dilution: 1:1000 Secondary Antibody: conjugated goat anti-rabbit Secondary Dilution: 1:10,000 Image Submitted By: Amy Gray Brigham Young University
Western Blot: CCT8 Antibody [NBP1-56608]

Western Blot: CCT8 Antibody [NBP1-56608]

Western Blot: CCT8 Antibody [NBP1-56608] - C-terminal region validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.

Applications for CCT8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCT8

As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Alternate Names

C21orf112, Cctq, CCT-theta, chaperonin containing TCP1, subunit 8 (theta), chromosome 21 open reading frame 112, D21S246, KIAA0002, PRED71, T-complex protein 1 subunit theta, T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15, TCP-1-theta

Gene Symbol

CCT8

Additional CCT8 Products

Product Documents for CCT8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCT8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCT8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCT8 Antibody - BSA Free and earn rewards!

Have you used CCT8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies