CD3 zeta Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00000919-D01P

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all CD3 zeta/CD247 Primary Antibodies »

Product Specifications

Immunogen

CD247 (NP_932170.1, 1 a.a. - 164 a.a.) full-length human protein. MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Specificity

CD247 - CD247 molecule,

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for CD3 zeta Antibody - Azide and BSA Free

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in rat brain.
Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in IMR-32.
Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in Raw 264.7.
Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in mouse kidney.
Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in mouse brain.
Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P]

Western Blot: CD3 zeta Antibody [H00000919-D01P] - Analysis of CD247 expression in transfected 293T cell line by CD247 polyclonal antibody.Lane 1: CD247 transfected lysate(18.70 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: CD3 zeta Antibody [H00000919-D01P]

Proximity Ligation Assay: CD3 zeta Antibody [H00000919-D01P]

Proximity Ligation Assay: CD3 zeta Antibody [H00000919-D01P] - Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Applications for CD3 zeta Antibody - Azide and BSA Free

Application
Recommended Usage

Proximity Ligation Assay

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CD3 zeta/CD247

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Long Name

T-cell Receptor zeta

Alternate Names

CD247, CD3H, CD3Q, CD3Z, IMD25, T3Z, TCR Zeta Chain

Entrez Gene IDs

919 (Human)

Gene Symbol

CD247

UniProt

NP_932170.1 (Human)

Additional CD3 zeta/CD247 Products

Product Documents for CD3 zeta Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD3 zeta Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD3 zeta Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CD3 zeta Antibody - Azide and BSA Free and earn rewards!

Have you used CD3 zeta Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies