CD35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13870

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD35 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Analysis in human tonsil and skeletal muscle tissues using NBP2-13870 antibody. Corresponding CD35 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human skletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870]

Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.

Applications for CD35 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD35

CD35 encodes a membrane glycoprotein found on peripheral blood cells, glomerular podocytes, and follicular dendritic cells. The protein is a receptor for complement components C3b and C4b and regulates the activity of the complement cascade. Variation in this protein is the basis of the Knops blood group system. The two most common alleles, F and S, differ by 8 exons and are thought to be the result of an unequal crossover event. A secreted form of the protein present in plasma has been described, but its full length nature has not been determined.

Alternate Names

C3BR, CD35, CR1, KN

Gene Symbol

CR1

Additional CD35 Products

Product Documents for CD35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CD35 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD35 Antibody - BSA Free and earn rewards!

Have you used CD35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...