CD36 Antibody (7P0S7)

Novus Biologicals | Catalog # NBP3-15616

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7P0S7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD36 (P16671). FASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD36 Antibody (7P0S7)

Western Blot: CD36 Antibody (7P0S7) [NBP3-15616]

Western Blot: CD36 Antibody (7P0S7) [NBP3-15616]

Western Blot: CD36 Antibody (7P0S7) [NBP3-15616] - Western blot analysis of extracts of various cell lines, using CD36 antibody (NBP3-15616) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

Applications for CD36 Antibody (7P0S7)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CD36

Originally discovered in platelets, cluster of differentiation 36, CD36, (also known as thrombospondin receptor, fatty acid translocase (FAT), platelet membrane glycoprotein IV (GPIV), and scavenger receptor class B, member 3 (SR-B3)) is a plasma membrane glycoprotein belonging to the class B scavenger receptor family (1,2). Human, mouse, and rat CD36 is synthesized as a 472 amino acid (a.a.) protein with a theoretical molecular weight of 53 kDa for the canonical isoform (3). Its domains include a short cytoplasmic tail at the N-terminal and C-terminal and a large extracellular loop flanked on each side by a transmembrane domain. The extracellular domain facilitates the update of fatty acids (FFAs), phospholipids, and cholesterol by forming two hydrophobic cavities, which was first modeled in the CD36 homologue, LIMP-2/ SCARB2 (4).

The expression of CD36 has been reported in platelets, erythrocytes, monocytes, differentiated adipocytes, skeletal muscle, mammary epithelial cells, spleen cells, some skin microdermal endothelial cells, and in cancer. Circulating levels of soluble CD36 (sCD36) has also been reported in chronic inflammatory disease such as type 2 diabetes and chronic kidney disease. CD36 participates in angiogenesis, innate immunity, and the clearance of apoptotic phagocytes. In lipid metabolism, CD36 functions as a macrophage receptor for oxidized LDL and as an adipocyte receptor/transporter for long-chain FFAs. Plasmodium falciparum, the parasite that causes malaria, binds CD36 via PfEMP1 proteins, tethering parasite-infected erythrocytes to endothelial receptors (5). Anti-CD36 isoantibodies have been detected in Type 1 CD36-deficient mothers and is implicated as the cause of fetal/neonatal alloimmune thrombocytopenia (6).

References

1) Febbraio, M., Hajjar, D. P., & Silverstein, R. L. (2001). CD36: a class B scavenger receptor involved in angiogenesis, atherosclerosis, inflammation, and lipid metabolism. The Journal of clinical investigation, 108(6), 785-791. PMID: 11560944

2) Silverstein RL, Febbraio M. (2000) CD36 and atherosclerosis. Curr Opin Lipidol. 2000 11(5):483-91. PMID: 11048891.

3) Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA. (1993) CD36 is a receptor for oxidized low density lipoprotein. J Biol Chem. 268(16):11811-6. PMID: 7685021.

4) Wang, J., & Li, Y. (2019). CD36 tango in cancer: signaling pathways and functions. Theranostics, 9(17), 4893-4908. PMID: 31410189

5) Hsieh FL, Turner L, Bolla JR, Robinson CV, Lavstsen T, Higgins MK. (2016) The structural basis for CD36 binding by the malaria parasite. Nat Commun. 7:12837. PMID: 27667267

6) Gruarin P, Ulliers D, Thorne RF, Alessio M. (2000) Methionine 156 in the immunodominant domain of CD36 contributes to define the epitope recognized by the NL07 MoAb. Mol Cell Biochem 214, 115-121. PMID: 11195795.

Alternate Names

BDPLT10, CD36 antigen (collagen type I receptor, thrombospondin receptor), CD36 molecule (thrombospondin receptor), CHDS7, cluster determinant 36, FAT, Fatty acid translocase, Glycoprotein IIIb, GP3B, GP4, GPIIIB, GPIV, leukocyte differentiation antigen CD36, PAS IV, PAS-4 protein, PASIV, platelet glycoprotein 4, platelet glycoprotein IV, SCARB3, scavenger receptor class B, member 3

Gene Symbol

CD36

Additional CD36 Products

Product Documents for CD36 Antibody (7P0S7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD36 Antibody (7P0S7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD36 Antibody (7P0S7)

There are currently no reviews for this product. Be the first to review CD36 Antibody (7P0S7) and earn rewards!

Have you used CD36 Antibody (7P0S7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...