CD37 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33970

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD37 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining in human tonsil and cerebral cortex tissues using anti-CD37 antibody. Corresponding CD37 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human lymph node.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human testis.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human spleen.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Analysis in human tonsil and skeletal muscle tissues. Corresponding CD37 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-CD37 antibody NBP2-33970 (A) shows similar protein distribution across tissues to independent antibody NBP2-33969 (B).
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970]

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for CD37 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD37

CD37, also known as GP52-40, TSPAN26, MGC120234. Enterz Protein NP_001035120. It is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

CD37, TSPAN26

Gene Symbol

CD37

UniProt

Additional CD37 Products

Product Documents for CD37 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD37 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CD37 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD37 Antibody - BSA Free and earn rewards!

Have you used CD37 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...