CD69 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37926

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD69 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CD69 Antibody - BSA Free (NBP2-37926) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD69 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Staining of human duodenum shows moderate membranous positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Staining of human pancreas shows no positivity in exocrine and endocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Staining of human tonsil shows moderate membranous positivity mainly in germinal center cells.
Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Staining in human tonsil and pancreas tissues. Corresponding CD69 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Analysis in human lymph node and skeletal muscle tissues using NBP2-37926 antibody. Corresponding CD69 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926]

Immunohistochemistry-Paraffin: CD69 Antibody [NBP2-37926] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Applications for CD69 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD69

CD69, also known as very early activation (VEA) antigen, is a disulfide-linked transmembrane homodimer whose differentially glycosylated subunits range from 35-39 kDa. (1,2) It is a C-type lectin, most closely related to the NKR-P1 and Ly-49 NK cell-activation molecules. (3) CD69 is widely expressed on hematopoietic cells, including lymphocytes, neutrophils and eosinophils. (1-4) Although not detectable on resting lymphocytes, its expression is rapidly (within 2 hours) upregulated upon activation of T, B and NK cells, and neutrophils. (4) Constitutive expression of CD69 on subsets of thymocytes suggests that it may be involved in regulation of developmental events in addition to its role in activation of a variety of hematopoietic cells. (4,5) MAb H1.2F3 augments PMA-induced T-cell proliferation,1,6 and induces redirected lysis of Fc receptor-bearing target cells by NK cells. (7)

Alternate Names

CD69, EA-1, Leu23, MLR-3, p60

Gene Symbol

CD69

UniProt

Q07108

Additional CD69 Products

Product Documents for CD69 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD69 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD69 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD69 Antibody - BSA Free and earn rewards!

Have you used CD69 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies