CD8 beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58425

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD8 beta Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EGISGTFVPQCLHGYYSNTTTSQKLLNPWILK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CD8 beta Antibody - BSA Free (NBP2-58425) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD8 beta Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CD8 beta Antibody [NBP2-58425]

Immunocytochemistry/ Immunofluorescence: CD8 beta Antibody [NBP2-58425]

Immunocytochemistry/Immunofluorescence: CD8 beta Antibody [NBP2-58425] - Staining of human cell line CACO-2 shows localization to plasma membrane. Antibody staining is shown in green.

Applications for CD8 beta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD8 beta

CD8b antigen is also known as T8, Lyt2, Ly-2, and CD8 beta. It is a member of the immunoglobulin superfamily expressed on most thymocytes, some mature T cell subsets, and macrophages. CD8b forms heterodimers with the CD8 alpha chain (CD8a). CD8 is an antigen co-receptor on T cells that interacts with MHC class I on antigen-presenting cells or epithelial cells. CD8 participates in T cell activation through its association with the T cell receptor complex and protein tyrosine kinase lck (p56lck).

Alternate Names

CD8 beta, CD8b, CD8B1, Leu2, LY3, LYT3, P37

Gene Symbol

CD8B

Additional CD8 beta Products

Product Documents for CD8 beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD8 beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD8 beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD8 beta Antibody - BSA Free and earn rewards!

Have you used CD8 beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies