Cdc14A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98508

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cdc14A Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is CDC14A - C-terminal region. Peptide sequence DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cdc14A Antibody - BSA Free

Western Blot: Cdc14A Antibody [NBP1-98508]

Western Blot: Cdc14A Antibody [NBP1-98508]

Western Blot: Cdc14A Antibody [NBP1-98508] - RPMI-8226 Cell Lysate 1.0ug/ml, Gel Concentration

Applications for Cdc14A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cdc14A

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms.

Alternate Names

CDC10 (cell division cycle 10, S. cerevisiae, homolog), cdc14, CDC14 cell division cycle 14 homolog A, CDC14 cell division cycle 14 homolog A (S. cerevisiae), Cdc14A1, Cdc14A2, dual specificity protein phosphatase CDC14A, EC 3.1.3.16, EC 3.1.3.48, hCDC14

Gene Symbol

CDC14A

UniProt

NP_003663 (Human)

Additional Cdc14A Products

Product Documents for Cdc14A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cdc14A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cdc14A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cdc14A Antibody - BSA Free and earn rewards!

Have you used Cdc14A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies