CDC25B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32627

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CDC25B Antibody - BSA Free (NBP2-32627) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CDC25B Antibody - BSA Free

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627]

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627]

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry: CDC25B Antibody [NBP2-32627]

Immunohistochemistry: CDC25B Antibody [NBP2-32627]

Immunohistochemistry: CDC25B Antibody [NBP2-32627] - Staining of human tonsil shows strong cytoplasmic positivity in subset of germinal center cells.
Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627]

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627]

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627]

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627]

Immunohistochemistry-Paraffin: CDC25B Antibody [NBP2-32627] - Staining in human lymph node and pancreas tissues using anti-CDC25B antibody. Corresponding CDC25B RNA-seq data are presented for the same tissues.

Applications for CDC25B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC25B

CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.

Long Name

Cell Division Cycle 25B

Alternate Names

CDC25HU2, cell division cycle 25 homolog B (S. cerevisiae), cell division cycle 25 homolog B (S. pombe), cell division cycle 25B, Dual specificity phosphatase Cdc25B, EC 3.1.3.48, M-phase inducer phosphatase 2

Gene Symbol

CDC25B

Additional CDC25B Products

Product Documents for CDC25B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDC25B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CDC25B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDC25B Antibody - BSA Free and earn rewards!

Have you used CDC25B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...