CDC7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32708

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CDC7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDC7 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CDC7 Antibody [NBP2-32708]

Immunocytochemistry/ Immunofluorescence: CDC7 Antibody [NBP2-32708]

Immunocytochemistry/Immunofluorescence: CDC7 Antibody [NBP2-32708] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle. Antibody stainng is shown in green.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708]

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708]

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708]

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708]

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708]

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708]

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
CDC7 Antibody

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] -

Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] -Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Applications for CDC7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 2 using NBP2-32708 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC7

DNA replication in eukaryotic cells is dependent on the phosphorylation of the pre-replicative complex (preRC) at the origin of replication. Two complexes of proteins mediate this event, the cyclin dependent kinase (CDK) complex, and the Cdc7 kinase-ASK complex. Human Cdc7 kinase consists of 574 amino acids with a molecular weight of 55 kDa. The activity of Cdc7 kinase oscillates during cell cycle. The major targets of Cdc7 kinase are proteins that belong to the MCM complex (mini chromosome maintenance proteins). Cdc7 kinase was also found to be important in meiosis, checkpoint responses, maintenance of chromosome structure, and repair.

Long Name

Cell division cycle 7-related protein kinase

Alternate Names

CDC7L1, HsCdc7, huCdc7

Gene Symbol

CDC7

Additional CDC7 Products

Product Documents for CDC7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDC7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDC7 Antibody - BSA Free (1)

2 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
100%
1 Stars
0%

Have you used CDC7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • CDC7 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: whole cell lysate and HCT116 whole cell lysate
    Species: HCT116 cells
    Verified Customer | Posted 08/27/2020
    HCT116 cell lysate: CDC7 siRNA KD
    10 fold primary Ab dilution; 0.8mg/ml lysate conc
    CDC7 Antibody - BSA Free NBP2-32708
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies