CDC73/HRPT2 Antibody (1B8Q1)

Novus Biologicals | Catalog # NBP3-33442

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1B8Q1
View all CDC73 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human CDC73/HRPT2 (NP_078805.3).

Sequence:
GKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CDC73/HRPT2 Antibody (1B8Q1)

CDC73/HRPT2 Antibody (1B8Q1)

Western Blot: CDC73/HRPT2 Antibody (1B8Q1) [NBP3-33442] -

Western Blot: CDC73/HRPT2 Antibody (1B8Q1) [NBP3-33442] - Western blot analysis of various lysates, using CDC73/HRPT2 Rabbit mAb at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for CDC73/HRPT2 Antibody (1B8Q1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDC73

Parafibromin, the product of gene HPRT2, acts as a tumor suppressor protein by inhibiting cell proliferation and blocking expression of cyclin D1 when overexpressed. Parafibromin has also been shown to bind with the PAF1 complex / RNA polymerase II which is involved with transcription elongation and the RNA processing pathway.

Long Name

Cell Division Cycle 73

Alternate Names

HPT-JT, HRPT2, Parafibromin

Gene Symbol

CDC73

Additional CDC73 Products

Product Documents for CDC73/HRPT2 Antibody (1B8Q1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDC73/HRPT2 Antibody (1B8Q1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Cell Cycle

Customer Reviews for CDC73/HRPT2 Antibody (1B8Q1)

There are currently no reviews for this product. Be the first to review CDC73/HRPT2 Antibody (1B8Q1) and earn rewards!

Have you used CDC73/HRPT2 Antibody (1B8Q1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies