Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 6O8F8
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 92-289 of human Cdk5 (NP_004926.1).
Sequence:
DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF
Sequence:
DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Cdk5 Antibody (6O8F8) (NBP3-33430) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Cdk5 Antibody (6O8F8)
Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] -
Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] - Western blot analysis of various lysates, using [KO Validated] Cdk5 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] -
Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] - Western blot analysis of lysates from wild type(WT) and Cdk5 knockout (KO) 293T cells, using [KO Validated] Cdk5 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Western Blot: Cdk5 Antibody (6O8F8) [Cdk5] -
Western Blot: Cdk5 Antibody (6O8F8) [Cdk5] - Western blot analysis of lysates from wild type(WT) and Cdk5 knockout (KO) 293T cells, using [KO Validated] Cdk5 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Applications for Cdk5 Antibody (6O8F8)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Western Blot
1:1000 - 1:5000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: CDK5
Long Name
Cyclin-dependent Kinase 5
Alternate Names
CDKN5, LIS7, PSSALRE
Gene Symbol
CDK5
Additional CDK5 Products
Product Documents for Cdk5 Antibody (6O8F8)
Product Specific Notices for Cdk5 Antibody (6O8F8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Cdk5 Antibody (6O8F8)
There are currently no reviews for this product. Be the first to review Cdk5 Antibody (6O8F8) and earn rewards!
Have you used Cdk5 Antibody (6O8F8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...