Cdk5 Antibody (6O8F8)

Novus Biologicals | Catalog # NBP3-33430

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6O8F8
View all CDK5 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 92-289 of human Cdk5 (NP_004926.1).

Sequence:
DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Cdk5 Antibody (6O8F8) (NBP3-33430) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Cdk5 Antibody (6O8F8)

Cdk5 Antibody (6O8F8)

Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] -

Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] - Western blot analysis of various lysates, using [KO Validated] Cdk5 Rabbit mAb at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Cdk5 Antibody (6O8F8)

Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] -

Western Blot: Cdk5 Antibody (6O8F8) [NBP3-33430] - Western blot analysis of lysates from wild type(WT) and Cdk5 knockout (KO) 293T cells, using [KO Validated] Cdk5 Rabbit mAb at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Cdk5 Antibody (6O8F8)

Western Blot: Cdk5 Antibody (6O8F8) [Cdk5] -

Western Blot: Cdk5 Antibody (6O8F8) [Cdk5] - Western blot analysis of lysates from wild type(WT) and Cdk5 knockout (KO) 293T cells, using [KO Validated] Cdk5 Rabbit mAb at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for Cdk5 Antibody (6O8F8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDK5

Long Name

Cyclin-dependent Kinase 5

Alternate Names

CDKN5, LIS7, PSSALRE

Gene Symbol

CDK5

Additional CDK5 Products

Product Documents for Cdk5 Antibody (6O8F8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cdk5 Antibody (6O8F8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cdk5 Antibody (6O8F8)

There are currently no reviews for this product. Be the first to review Cdk5 Antibody (6O8F8) and earn rewards!

Have you used Cdk5 Antibody (6O8F8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies