CDYL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52986

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CDYL Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CDYL Antibody - BSA Free

Western Blot: CDYL Antibody [NBP1-52986]

Western Blot: CDYL Antibody [NBP1-52986]

Western Blot: CDYL Antibody [NBP1-52986] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP1-52986]

Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP1-52986]

Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: MD MB231, Primary Antibody Dilution: 4 ug/ml
Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP1-52986]

Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP1-52986]

Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml

Applications for CDYL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDYL

CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.

Alternate Names

CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like), CDY-like, CDY-like, autosomal, chromodomain protein, Y chromosome-like, chromodomain protein, Y-like, chromodomain Y-like protein, DKFZp586C1622, EC 2.3.1.48, MGC131936, testis-specific chromodomain Y-like protein

Gene Symbol

CDYL

UniProt

Q9Y232 (Human)

Additional CDYL Products

Product Documents for CDYL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDYL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDYL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDYL Antibody - BSA Free and earn rewards!

Have you used CDYL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies