CEACAM1/CD66a Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85743

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CEACAM1/CD66a Antibody - BSA Free

Immunohistochemistry-Paraffin: CEACAM1/CD66a Antibody [NBP1-85743]

Immunohistochemistry-Paraffin: CEACAM1/CD66a Antibody [NBP1-85743]

Immunohistochemistry-Paraffin: CEACAM3 Antibody [NBP1-85743] - Staining of human duodenum shows strong cytoplasmic positivity in a subset of leukocytes.

Applications for CEACAM1/CD66a Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEACAM-1/CD66a

CEACAM1 encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of only two has been determined. [provided by RefSeq]

Long Name

Carcinoembryonic Antigen-related Cell Adhesion Molecule 1

Alternate Names

BGP1, Biliary Glycoprotein 1, CD66a, Cea-1, CEACAM1, Hv-1, Hv-2, MHVR

Gene Symbol

CEACAM1

Additional CEACAM-1/CD66a Products

Product Documents for CEACAM1/CD66a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEACAM1/CD66a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEACAM1/CD66a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEACAM1/CD66a Antibody - BSA Free and earn rewards!

Have you used CEACAM1/CD66a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies