Ceruloplasmin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82663

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Ceruloplasmin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Ceruloplasmin. Peptide sequence: HIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ceruloplasmin Antibody - BSA Free

Western Blot: Ceruloplasmin Antibody [NBP2-82663]

Western Blot: Ceruloplasmin Antibody [NBP2-82663]

Western Blot: Ceruloplasmin Antibody [NBP2-82663] - Host: Rabbit. Target Name: CP. Sample Tissue: Human Liver Tumor. Antibody Dilution: 1.0ug/ml

Applications for Ceruloplasmin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ceruloplasmin

The protein encoded by the Ceruloplasmin gene is a metalloprotein that binds most of the copper in plasma and is involved in theperoxidation of Fe(II)transferrin to Fe(III) transferrin. Mutations in this gene cause aceruloplasminemia, whichresults in iron accumulation and tissue damage, and is associated with diabetes and neurologic abnormalities.(provided by RefSeq)

Alternate Names

ceruloplasmin, ceruloplasmin (ferroxidase), CP-2, EC 1.16.3.1, Ferroxidase

Gene Symbol

CP

Additional Ceruloplasmin Products

Product Documents for Ceruloplasmin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ceruloplasmin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ceruloplasmin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ceruloplasmin Antibody - BSA Free and earn rewards!

Have you used Ceruloplasmin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Ceruloplasmin Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: We want to set up a Ceruloplasmin enzyme immunoassay. Could you suggest a suitable/optimal antibody pair for a sandwich format?

    A: Currently we do not carry any validated antibody pairs for sandwich ELISA to detect ceruloplasmin, however we do have ELISA kits that have been optimized and validated for human and rat.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies