cGAS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86761

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot, Simple Western

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all cGAS Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for cGAS Antibody - BSA Free

Simple Western: cGAS Antibody [NBP1-86761]

Simple Western: cGAS Antibody [NBP1-86761]

Simple Western: cGAS Antibody [NBP1-86761] - Simple Western lane view shows a specific band for MB21D1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: cGAS Antibody [NBP1-86761]

Simple Western: cGAS Antibody [NBP1-86761]

Simple Western: cGAS Antibody [NBP1-86761] - Electropherogram image(s) of corresponding Simple Western lane view. MB21D1 antibody was used at 1:30 dilution on RT-4 lysate(s).
cGAS Antibody - BSA Free Western Blot: cGAS Antibody - BSA Free [NBP1-86761]

Western Blot: cGAS Antibody - BSA Free [NBP1-86761]

Analysis in human cell line CACO-2 and human cell line HEK 293.
cGAS Antibody - BSA Free

Western Blot: cGAS Antibody - BSA Free [NBP1-86761] -

Hypoxia inhibited teniposide-induced cGAS-STING activation in human HCC cells. (A) Hep3B and Huh7 cells were cultured under a normoxic (21% O2) or a hypoxic (1% O2) condition for 18 hours and the cellular protein expression of HIF-1 alpha and cGAS was then detected by immunoblotting; beta -actin was used as a loading control. (B) Hep3B and Huh7 cells were transfected with HT-DNA (5 ug/mL) and the cells were then cultured under either normoxic or hypoxic condition for 24 hours; the cellular protein expression of p-IRF3 was detected by immunoblotting. (C) Hep3B and Huh7 cells were treated with teniposide at each IC50, followed by either normoxic or hypoxic culture for 24 hours, and the cellular protein expression of p-IRF3 and p-P65 was then detected by immunoblotting. (D) Hep3B and Huh7 cells were treated as in (C) and the supernatant IFN-beta was then measured by ELISA. (E–F) Hep3B and Huh7 cells were treated as in (C) and the mRNA expression of IFIT-1 and IFIT-2 (E) and CCL5 and CXCL10 (F) was then measured by RT-qPCR. Data in (A), (B) and (C) are representative of three independent experiments. Data in (D), (E) and (F) are shown as mean+/-SD of three independent experiments. *P<0.05, **P<0.01, ***P<0.001. cGAS-STING, cyclic GMP-AMP synthase-stimulator of interferon genes; HCC, hepatocellular carcinoma; HIF-1 alpha, hypoxia inducible factor 1 alpha ; HT-DNA, herring testes-DNA; IC50, 50% inhibitory concentration; IFN-beta, interferon beta ; IRF3, interferon regulatory factor 3; Rel. expression, relative expression; RT-qPCR, real time quantitative PCR; Teni, teniposide. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36002188), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for cGAS Antibody - BSA Free

Application
Recommended Usage

Simple Western

1:30

Western Blot

0.04 - 0.4 ug/mL
Application Notes
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:30, apparent MW was 65 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reviewed Applications

Read 1 review rated 4 using NBP1-86761 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: cGAS

Alternate Names

C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1

Gene Symbol

CGAS

Additional cGAS Products

Product Documents for cGAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for cGAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for cGAS Antibody - BSA Free

Customer Reviews for cGAS Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used cGAS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • cGAS Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: human primary hepatocytes
    Species: Human
    Verified Customer | Posted 12/18/2017
    Review for anti-cGAS antibody (NBP1-86761)
    Name: Anti-cGAS antibody (NBP1-86761) Catalog #: Anti-cGAS antibody (NBP1-86761) Lot Number: Anti-cGAS antibody (NBP1-86761, Lot # G105753) PO/Order Number: Click here to enter text.. WB Image Description (Please provide labels for all lanes): lane 1: human primary hepatocytes; lane 2: Hep G2 Sample Information: Cell Line or Tissue: human primary hepatocytes, Hep G2 Species: human Treatment: No Lysate Preparation: Date of lysate preparation: December 7, 2017 Lysis buffer used: 1X lysis buffer from Cell Signaling by adding PMSF Reducing agent: beta-mercaptoethanol, DTT If boiled (temperature/time): Yes Controls: Positive Control: No Negative Control: No Loading Control (please attach additional images if applicable): No Protein Amount Loaded per lane: 20 ug Antibody Storage Conditions: -20℃ Electrophoresis: Gel Percentage: 10% Electrophoresis Conditions: Tris-Glycine-SDS at room temperature Voltage: 120V Time: 2 hours Membrane Transfer: Method (Submersion/Semi-dry): wet transfer Membrane Type (PVDF/Nitrocellulose): Nitrocellulose Time: 2 hours Voltage: 100V Blocking: Blocking Solution: 5% milk in 1X TBST Time: 1 hour at room temperature Primary Antibody: Dilution: 1/500 Diluent Buffer: 2.5% BSA Incubation Time: overnight Incubation Temperature: 4℃ Washing Conditions: Wash Solution: 1X TBST Time and Repetitions: 5 min each for 3 times Secondary Antibody Manufacturer and Catalog #: Promega, cat # W401B, Lot # 0000187662 Secondary description: goat anti-rabbit secondary antibody Dilution: 1/2000 Diluent Buffer: 3% milk Incubation Time: 1 hour Incubation Temperature: room temperature Detection Method: Detection: ECL (GE, cat # RPN2209, lot #n9838243) Procedure: Add equal volume of A and B, mix and apply on the membranes for 3-5 min before exposure Development Time: 3 min Molecular weight of band(s): ~55 kDa Experimental Concerns and Observations: Specific bands around 55 kDa were observed
    cGAS Antibody - BSA Free NBP1-86761

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies