CHCHD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54783

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHCHD4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CHCHD4(coiled-coil-helix-coiled-coil-helix domain containing 4) The peptide sequence was selected from the N terminal of CHCHD4. Peptide sequence MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHCHD4 Antibody - BSA Free

Western Blot: CHCHD4 Antibody [NBP1-54783]

Western Blot: CHCHD4 Antibody [NBP1-54783]

Western Blot: CHCHD4 Antibody [NBP1-54783] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Applications for CHCHD4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHCHD4

CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM].

Alternate Names

CHDH4, coiled-coil-helix-coiled-coil-helix domain containing 4, Coiled-coil-helix-coiled-coil-helix domain-containing protein 4, FLJ31709, MIA40mitochondrial intermembrane space import and assembly protein 40, mitochondrial intermembrane space import and assembly 40 homolog, TIMM40, translocase of inner mitochondrial membrane 40 homolog

Gene Symbol

CHCHD4

UniProt

Q8N4Q1 (Human)

Additional CHCHD4 Products

Product Documents for CHCHD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHCHD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHCHD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHCHD4 Antibody - BSA Free and earn rewards!

Have you used CHCHD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies