Chemokine-like factor Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59506

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Chemokine-like factor Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CKLF(chemokine-like factor) The peptide sequence was selected from the N terminal of CKLF. Peptide sequence MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Chemokine-like factor Antibody - BSA Free

Western Blot: Chemokine-like factor Antibody [NBP1-59506]

Western Blot: Chemokine-like factor Antibody [NBP1-59506]

Western Blot: Chemokine-like factor Antibody [NBP1-59506] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for Chemokine-like factor Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chemokine-like factor

CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

C32CKLF2, chemokine-like factor, chemokine-like factor 1, chemokine-like factor 2, chemokine-like factor 3, chemokine-like factor 4, CKLF1, CKLF3, CKLF4, HSPC224, transmembrane proteolipid, UCK-1

Gene Symbol

CKLF

Additional Chemokine-like factor Products

Product Documents for Chemokine-like factor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Chemokine-like factor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chemokine-like factor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chemokine-like factor Antibody - BSA Free and earn rewards!

Have you used Chemokine-like factor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies