CHMP1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55512

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHMP1B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CHMP1B(chromatin modifying protein 1B) Antibody(against the N terminal of CHMP1B. Peptide sequence KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHMP1B Antibody - BSA Free

Western Blot: CHMP1B Antibody [NBP1-55512]

Western Blot: CHMP1B Antibody [NBP1-55512]

Western Blot: CHMP1B Antibody [NBP1-55512] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for CHMP1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP1B

CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).

Alternate Names

C10orf2, c18orf2, charged multivesicular body protein 1b, CHMP1.5, CHMP1b, chromatin modifying protein 1B, Chromatin-modifying protein 1b, hVps46-2, vacuolar protein sorting 46-2, Vacuolar protein sorting-associated protein 46-2, Vps46-2, Vps46B

Gene Symbol

CHMP1B

UniProt

Q7LBR1 (Human)

Additional CHMP1B Products

Product Documents for CHMP1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHMP1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHMP1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHMP1B Antibody - BSA Free and earn rewards!

Have you used CHMP1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies