CHMP4B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87183

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CHMP4B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B. Peptide sequence: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHMP4B Antibody - BSA Free

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Rabbit. Target Name: CHMP4B. Sample Tissue: Human Lung Tumor. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP2-87183]

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP2-87183]

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP2-87183] - Rabbit Anti-CHMP4B antibody. Formalin Fixed Paraffin Embedded Tissue: Human Kidney. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.
Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Rabbit. Target Name: CHMP4B. Sample Tissue: Human Hela. Antibody Dilution: 1.0ug/ml
Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Mouse. Target Name: CHMP4B. Sample Tissue: Mouse Skeletal Muscle. Antibody Dilution: 1ug/ml
Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Rabbit. Target: CHMP4B. Positive control (+): MCF7 (N10). Negative control (-): Human liver (LI). Antibody concentration: 1ug/ml
Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Rabbit. Target Name: CHMP4B. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 3ug/ml

Applications for CHMP4B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP4B

Component of the escrt-iii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-iii complex is probably involved in the concentration of mvb cargo. in the escrt-iii complex, it probably serves as an acceptor for escrt-i complex on endosomal membranes. in case of infection, the hiv-1 virus takes advantage of the escrt-iii complex for budding and exocytic cargos of viral proteins, via the association of chmp4 proteins with pdcd6ip/aip1, a protein directly recruited by hiv-1 p6 protein that functions at sites of viral gag assembly and budding.

Alternate Names

C20orf178, charged multivesicular body protein 4b, CHMP4A, CHMP4b, chromatin modifying protein 4B, Chromatin-modifying protein 4b, chromosome 20 open reading frame 178, dJ553F4.4, hSnf7-2, hVps32-2, Shax1, SNF7, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, SNF7-2CTPP3, Vacuolar protein sorting-associated protein 32-2, vacuolar protein-sorting-associated protein 32-2, Vps32-2, VPS32B

Gene Symbol

CHMP4B

Additional CHMP4B Products

Product Documents for CHMP4B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHMP4B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHMP4B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHMP4B Antibody - BSA Free and earn rewards!

Have you used CHMP4B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies