CHMP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87186

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CHMP6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CHMP6. Peptide sequence: VMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHMP6 Antibody - BSA Free

Western Blot: CHMP6 Antibody [NBP2-87186]

Western Blot: CHMP6 Antibody [NBP2-87186]

Western Blot: CHMP6 Antibody [NBP2-87186] - WB Suggested Anti-CHMP6 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Applications for CHMP6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP6

Component of the escrt-iii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-iii complex is probably involved in the concentration of mvb cargo. in the escrt-iii complex, it probably serves as an acceptor for escrt-ii complex on endosomal membranes.

Alternate Names

charged multivesicular body protein 6, chromatin modifying protein 6, Chromatin-modifying protein 6, FLJ11749, Vacuolar protein sorting-associated protein 20, Vps20, VPS20hVps20

Gene Symbol

CHMP6

Additional CHMP6 Products

Product Documents for CHMP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHMP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHMP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHMP6 Antibody - BSA Free and earn rewards!

Have you used CHMP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies