Chromogranin B Antibody (5N6T1)

Novus Biologicals | Catalog # NBP3-16206

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5N6T1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Chromogranin B (P05060). EEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Chromogranin B Antibody (5N6T1)

Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206]

Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206]

Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206] - Western blot analysis of extracts of various cell lines, using Chromogranin B antibody (NBP3-16206) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206]

Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206]

Western Blot: Chromogranin B Antibody (5N6T1) [NBP3-16206] - Western blot analysis of extracts of Mouse brain cells, using Chromogranin B antibody (NBP3-16206) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Chromogranin B Antibody (5N6T1)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Chromogranin B

The Chromogranin B gene encodes a tyrosine-sulfated secretory protein abundant in peptidergic endocrine cells and neurons. Thisprotein may serve as a precursor for regulatory peptides. (provided by RefSeq)

Alternate Names

CHGB, SCG1, Secretogranin I

Gene Symbol

CHGB

Additional Chromogranin B Products

Product Documents for Chromogranin B Antibody (5N6T1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chromogranin B Antibody (5N6T1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chromogranin B Antibody (5N6T1)

There are currently no reviews for this product. Be the first to review Chromogranin B Antibody (5N6T1) and earn rewards!

Have you used Chromogranin B Antibody (5N6T1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...