CHST11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68912

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHST11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Chst11 (carbohydrate (chondroitin 4) sulfotransferase 11) The peptide sequence was selected from the C terminal of Chst11. Peptide sequence FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHST11 Antibody - BSA Free

Western Blot: CHST11 Antibody [NBP1-68912]

Western Blot: CHST11 Antibody [NBP1-68912]

Western Blot: CHST11 Antibody [NBP1-68912] - Rat Kidney lysate, concentration 0.2-1 ug/ml.

Applications for CHST11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHST11

Chst11 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Chst11 can also sulfate Gal residues in desulfated dermatan sulfate. Chst11 preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.

Alternate Names

C4S-1, C4ST, C4St-1, C4ST1EC 2.8.2.5, carbohydrate (chondroitin 4) sulfotransferase 11, carbohydrate sulfotransferase 11, Chondroitin 4-O-sulfotransferase 1, Chondroitin 4-sulfotransferase 1, DKFZp667A035, FLJ41682, HSA269537, IgH/CHST11 fusion

Gene Symbol

CHST11

UniProt

P69478 (Rat)

Additional CHST11 Products

Product Documents for CHST11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHST11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHST11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHST11 Antibody - BSA Free and earn rewards!

Have you used CHST11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies