CHST8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62239

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHST8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CHST8(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8) The peptide sequence was selected form the middle region of CHST8. Peptide sequence GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CHST8 Antibody - BSA Free

Western Blot: CHST8 Antibody [NBP1-62239]

Western Blot: CHST8 Antibody [NBP1-62239]

Western Blot: CHST8 Antibody [NBP1-62239] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: CHST8 Antibody [NBP1-62239]

Western Blot: CHST8 Antibody [NBP1-62239]

Western Blot: CHST8 Antibody [NBP1-62239] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CHST8 Antibody [NBP1-62239]

Western Blot: CHST8 Antibody [NBP1-62239]

Western Blot: CHST8 Antibody [NBP1-62239] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Applications for CHST8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHST8

Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]).[supplied by OMIM].

Alternate Names

carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8, carbohydrate sulfotransferase 8, EC 2.8.2.-, GalNAc-4-O-sulfotransferase 1, GalNAc4ST, GALNAC4ST1, GalNAc-4-ST1, galNAc4ST-1, N-acetylgalactosamine-4-O-sulfotransferase 1

Gene Symbol

CHST8

OMIM

NP_071912 (Human)

UniProt

Q9H2A9 (Human)

Additional CHST8 Products

Product Documents for CHST8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHST8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHST8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHST8 Antibody - BSA Free and earn rewards!

Have you used CHST8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies