Chymotrypsin-like protease Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58056

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Chymotrypsin-like protease Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Chymotrypsin-like protease Antibody - BSA Free

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056]

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Applications for Chymotrypsin-like protease Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chymotrypsin-like protease

CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).

Alternate Names

chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821

Gene Symbol

CTRL

UniProt

P40313 (Human)

Additional Chymotrypsin-like protease Products

Product Documents for Chymotrypsin-like protease Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Chymotrypsin-like protease Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chymotrypsin-like protease Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chymotrypsin-like protease Antibody - BSA Free and earn rewards!

Have you used Chymotrypsin-like protease Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies