CIB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58792

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CIB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CIB1 Antibody - BSA Free (NBP2-58792) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CIB1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CIB1 Antibody [NBP2-58792]

Immunocytochemistry/ Immunofluorescence: CIB1 Antibody [NBP2-58792]

Immunocytochemistry/Immunofluorescence: CIB1 Antibody [NBP2-58792] - Staining of human cell line A549 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Applications for CIB1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CIB1

CIB1(also designated calcium and integrin binding 1 or calmyrin),with 191-amino acid protein(about 21kDa), belongs to the calcium-binding protein family.CIB1 is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining.CIB1 is an EF-hand-containing protein that binds multiple effector proteins, including the platelet alpha(IIb)beta(3) integrin and several serine/threonine kinases and potentially modulates their function.CIB1 regulates platelet aggregation in hemostasis through a specific interaction with the alpha(IIb) cytoplasmic domain of platelet integrin alpha(IIb)beta(3). CIB1 is also ubiquitously expressed activating and inhibiting protein ligand of the InsP3R.

Long Name

Calcium and Integrin Binding 1

Alternate Names

Calmyrin, CIBP, KIP, PRKDCIP, SIP2-28

Gene Symbol

CIB1

Additional CIB1 Products

Product Documents for CIB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CIB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CIB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CIB1 Antibody - BSA Free and earn rewards!

Have you used CIB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies