Cklfsf8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59463

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cklfsf8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CMTM8(CKLF-like MARVEL transmembrane domain containing 8) The peptide sequence was selected from the middle region of CMTM8. Peptide sequence CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cklfsf8 Antibody - BSA Free

Western Blot: Cklfsf8 Antibody [NBP1-59463]

Western Blot: Cklfsf8 Antibody [NBP1-59463]

Western Blot: Cklfsf8 Antibody [NBP1-59463] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Cklfsf8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cklfsf8

Cmtm8 gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Alternate Names

chemokine-like factor super family 8, chemokine-like factor superfamily 8, Chemokine-like factor superfamily member 8, CKLF-like MARVEL transmembrane domain containing 8, CKLF-like MARVEL transmembrane domain-containing protein 8, CKLFSF8, CKLFSF8-V2

Gene Symbol

CMTM8

UniProt

Q8IZV2 (Human)

Additional Cklfsf8 Products

Product Documents for Cklfsf8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cklfsf8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cklfsf8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cklfsf8 Antibody - BSA Free and earn rewards!

Have you used Cklfsf8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies