CKMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13841

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CKMT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841]

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841]

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841] - Staining in human heart muscle and lymph node tissues using anti-CKMT2 antibody. Corresponding CKMT2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841]

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841]

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841]

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841]

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
CKMT2 Antibody - BSA Free

Western Blot: CKMT2 Antibody - BSA Free [NBP2-13841] -

BMP7 treatment upregulated creatine futile cycle-mediated thermogenesis in SC and DN derived differentiated adipocytes. SC and DN preadipocytes were differentiated and treated as in Figure 1, Figure 2, Figure 3, Figure 4 and Figure 5. (A) Representative time lapse OCR curve after indicated treatments, followed by quantification of creatine cycle related ( beta -GPA inhibited) OCR (n = 5). (B) Quantification of gene expression of CKMT2 by RNA-sequencing (n = 9) and RT-qPCR (n = 5), followed by protein expression (n = 5). (C) Quantification of gene expression of CKB by RNA-sequencing (n = 9), followed by protein expression (n = 4). (D) Quantification of gene expression of TNAP by RNA-sequencing (n = 9). Data expressed as mean +/- SD. RT-qPCR was normalized to GAPDH, protein expression was normalized to beta -actin. * p < 0.05, ** p < 0.01. Statistics: one-way ANOVA with Tukey’s post-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34832860), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CKMT2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CKMT2

CKMT2 belongs to the creatine kinase isoenzyme family, and is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It exists as two isoenzymes, sarcomeric CKMT2 and ubiquitous CKMT2, which are encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

Alternate Names

Basic-type mitochondrial creatine kinase, creatine kinase S-type, mitochondrial, creatine kinase, mitochondrial 2 (sarcomeric), EC 2.7.3, EC 2.7.3.2, mib-CK, Sarcomeric mitochondrial creatine kinase, SMTCK, S-MtCK

Gene Symbol

CKMT2

Additional CKMT2 Products

Product Documents for CKMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CKMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CKMT2 Antibody - BSA Free

Customer Reviews for CKMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CKMT2 Antibody - BSA Free and earn rewards!

Have you used CKMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...