Claudin-6 Antibody - Azide and BSA Free

Name: Claudin-6 Antibody - Azide and BSA Free
Brand: Novus Biologicals
SKU: NBP3-16019
Price: 349 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16019

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

View all Claudin-6 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin-6 (NP_067018.2). SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Claudin-6 Antibody - Azide and BSA Free

Western Blot: Claudin-6 AntibodyAzide and BSA Free [NBP3-16019]

Western Blot: Claudin-6 Antibody [NBP3-16019] - Western blot analysis of extracts of OVCAR3 cells, using Claudin 6 antibody (NBP3-16019) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: Claudin-6 AntibodyAzide and BSA Free [NBP3-16019]

Western Blot: Claudin-6 Antibody [NBP3-16019] - Western blot analysis of extracts of Rat brain, using Claudin 6 antibody (NBP3-16019) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Claudin-6 Antibody - Azide and BSA Free

Application

Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Claudin-6

The claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the claudins, Occludin and junction adhesion molecule. Claudins, which consist of four transmembrane domains and two extracellular loops make up tight junction strands. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions. Claudin-6 is expressed in differentiated F9 cells that resemble tight junction-bearing viceral endoderm resulting from stimulation with retinoc acid and mediated by RXRalpha and RARgamma. Claudin-6 is absent in mouse brain and lung. The human claudin-6 gene maps to chromosome 16p13.3.

Alternate Names

Claudin6, CLDN6, Skullin 2

Gene Symbol

CLDN6

Additional Claudin-6 Products

Product Documents for Claudin-6 Antibody - Azide and BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Claudin-6 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.