CLEC14A (C-type lectin domain family 14 member A; also EGFR5) is a 51 kDa (predicted) member of the C-type lectin domain family of proteins. It is a type I transmembrane protein, apparently expressed in brain and about which little is known. Mature human CLEC14A is 469 amino acids in length. It contains a 376 aa extracellular region (aa 22-397) and a 72 aa cytoplasmic domain. The extracellular region shows one C-type lectin like domain (aa 32-175) and an EGF-like region (aa 245-287). Over aa 22-397, human CLEC14A shares 66% and 81% aa identity with mouse and canine CLEC14A, respectively.
CLEC14A Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-30854
![Western Blot: CLEC14A Antibody [NBP2-30854]](https://resources.rndsystems.com/images/products/CLEC14A-Antibody-Western-Blot-NBP2-30854-img0006.jpg "Western Blot: CLEC14A Antibody [NBP2-30854]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CLEC14A Antibody - BSA Free
Western Blot: CLEC14A Antibody [NBP2-30854]
Western Blot: CLEC14A Antibody [NBP2-30854] - Analysis in control (vector only transfected HEK293T lysate) and CLEC14A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).![Immunocytochemistry/ Immunofluorescence: CLEC14A Antibody [NBP2-30854]](https://resources.rndsystems.com/images/products/CLEC14A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30854-img0005.jpg "Immunocytochemistry/ Immunofluorescence: CLEC14A Antibody [NBP2-30854]")
Immunocytochemistry/ Immunofluorescence: CLEC14A Antibody [NBP2-30854]
Immunocytochemistry/Immunofluorescence: CLEC14A Antibody [NBP2-30854] - Staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]](https://resources.rndsystems.com/images/products/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0011.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]")
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human liver shows low positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]](https://resources.rndsystems.com/images/products/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0008.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]")
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human lung shows strong membranous positivity in respitory epithelial cells.![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]](https://resources.rndsystems.com/images/products/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0009.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]")
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human placenta shows moderate to strong membranous positivity in endothelial cells.![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]](https://resources.rndsystems.com/images/products/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0010.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]")
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854]
Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human cerebral cortex shows strong membranous positivity in endothelial cells.Applications for CLEC14A Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CLEC14A
Long Name
C-type Lectin Domain Family 14, Member A
Alternate Names
CEG1, EGF R5
Gene Symbol
CLEC14A
UniProt
Additional CLEC14A Products
Product Documents for CLEC14A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CLEC14A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for CLEC14A Antibody - BSA Free
Powered by Bioz
Customer Reviews for CLEC14A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CLEC14A Antibody - BSA Free and earn rewards!
Have you used CLEC14A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...