Coactosin-like Protein 1/CotL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54851

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Coactosin-like Protein 1/CotL1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to COTL1(coactosin-like 1 (Dictyostelium)) The peptide sequence was selected from the N terminal of COTL1. Peptide sequence MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Coactosin-like Protein 1/CotL1 Antibody - BSA Free

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851]

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851]

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851] - Analysis of HeLa cell lysate (30ug) using anti-COTL1 antibody. Image from verified customer review.
Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851]

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851]

Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Applications for Coactosin-like Protein 1/CotL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-54851 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Coactosin-like Protein 1/CotL1

This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has

Alternate Names

CLP, Coactosin like Protein 1, COTL1

Gene Symbol

COTL1

UniProt

Q14019 (Human)

Additional Coactosin-like Protein 1/CotL1 Products

Product Documents for Coactosin-like Protein 1/CotL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Coactosin-like Protein 1/CotL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Neuronal Markers

Customer Reviews for Coactosin-like Protein 1/CotL1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Coactosin-like Protein 1/CotL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Hela Cell Lysate
    Species: Human
    Verified Customer | Posted 10/07/2014
    COTL1 WB in HeLa cells
    Coactosin-like Protein 1/CotL1 Antibody - BSA Free NBP1-54851

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies