Collagen IX alpha 2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92360

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Collagen IX alpha 2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 600-689 of human Collagen IX alpha 2 (NP_001843.1). RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Collagen IX alpha 2 Antibody - Azide and BSA Free

Western Blot: Collagen IX alpha 2 AntibodyAzide and BSA Free [NBP2-92360]

Western Blot: Collagen IX alpha 2 AntibodyAzide and BSA Free [NBP2-92360]

Western Blot: Collagen IX alpha 2 Antibody [NBP2-92360] - Analysis of extracts of Rat liver, using Collagen IX alpha 2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5min.

Applications for Collagen IX alpha 2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Collagen IX alpha 2

Alternate Names

Alpha 2 Type IX Collagen, COL9A2, Collagen Alpha-2(IX) Chain, Collagen IX, Alpha-2 Polypeptide, Collagen, Type IX, Alpha 2, DJ39G22.4, EDM2, MED, STL5

Gene Symbol

COL9A2

Additional Collagen IX alpha 2 Products

Product Documents for Collagen IX alpha 2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Collagen IX alpha 2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Collagen IX alpha 2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Collagen IX alpha 2 Antibody - Azide and BSA Free and earn rewards!

Have you used Collagen IX alpha 2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies