Connexin 58/GJA9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59196

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GJA9(gap junction protein, alpha 9, 59kDa) The peptide sequence was selected from the middle region of GJA9. Peptide sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Connexin 58/GJA9 Antibody - BSA Free

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Fetal Muscle.
Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Fetal Liver.
Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196]

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Adult Placenta.

Applications for Connexin 58/GJA9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Connexin 58/GJA9

Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-612 BI463634.1 7-618 613-1929 AF271261.1 585-1901 1930-2331 BU689816.1 1-402 c

Alternate Names

CX58, CX59, GJA9

Gene Symbol

GJA9

UniProt

Additional Connexin 58/GJA9 Products

Product Documents for Connexin 58/GJA9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Connexin 58/GJA9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Connexin 58/GJA9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Connexin 58/GJA9 Antibody - BSA Free and earn rewards!

Have you used Connexin 58/GJA9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...