COQ2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59613

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COQ2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to COQ2(coenzyme Q2 homolog, prenyltransferase (yeast)) The peptide sequence was selected from the middle region of COQ2. Peptide sequence FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COQ2 Antibody - BSA Free

Western Blot: COQ2 Antibody [NBP1-59613]

Western Blot: COQ2 Antibody [NBP1-59613]

Western Blot: COQ2 Antibody [NBP1-59613] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Western Blot: COQ2 Antibody [NBP1-59613]

Western Blot: COQ2 Antibody [NBP1-59613]

Western Blot: COQ2 Antibody [NBP1-59613] - DU145 cell lysate, concentration 0.2-1 ug/ml.

Applications for COQ2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COQ2

COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514

Alternate Names

4-hydroxybenzoate polyprenyltransferase, coenzyme Q2 homolog, prenyltransferase (yeast), COQ2 homolog, EC 2.5.1, EC 2.5.1.39, FLJ13014, hCOQ2, mitochondrial, Para-hydroxybenzoate--polyprenyltransferase, para-hydroxybenzoate-polyprenyltransferase, mitochondrial, PHB:polyprenyltransferase

Gene Symbol

COQ2

UniProt

Q96H96 (Human)

Additional COQ2 Products

Product Documents for COQ2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COQ2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COQ2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COQ2 Antibody - BSA Free and earn rewards!

Have you used COQ2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies