COQ5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82738

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all COQ5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ5. Peptide sequence: RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGI The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for COQ5 Antibody - BSA Free

Western Blot: COQ5 Antibody [NBP2-82738]

Western Blot: COQ5 Antibody [NBP2-82738]

Western Blot: COQ5 Antibody [NBP2-82738] - WB Suggested Anti-Coq5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Lung
COQ5 Antibody

Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-82738] -

Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-82738] - Analysis of Rabbit Polyclonal COQ5 Antibody using mouse liver tissue. A band at the expected molecular weight (about 37kDa) is observed. Technical data: Blocking in milk. Primary antibody dilution: 1:500. Secondary antibody dilution: 1:2500. Image from a verified customer review.

Applications for COQ5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP2-82738 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COQ5

Converts DDMQH2 into DMQH2

Alternate Names

coenzyme Q5 homolog, methyltransferase (S. cerevisiae), coenzyme Q5 homolog, methyltransferase (yeast), EC 2.1.1, EC 2.1.1.-, EC 2.1.1.52, MGC104303, MGC4767, ubiquinone biosynthesis methyltransferase COQ5, mitochondrial

Gene Symbol

COQ5

Additional COQ5 Products

Product Documents for COQ5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COQ5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for COQ5 Antibody - BSA Free

Customer Reviews for COQ5 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used COQ5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • COQ5 Antibody
    Name: Luis Carlos López García
    Application: Western Blot
    Sample Tested: Liver tissue and Liver
    Species: Mouse
    Verified Customer | Posted 04/08/2024
    A band at the expected molecular weight (about 37kDa) is observed, so we can confirm that this antibody is useful in mice. Technical data: Blocking in milk. Primary antibody dilution: 1:500. Secondary antibody dilution: 1:2500.
    COQ5 Antibody - BSA Free NBP2-82738
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies