Recombinant Human COX IV Isoform 2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00084701-P01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE
View all COX4-I2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-171 of Human COX4I2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

44.55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human COX IV Isoform 2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human COX IV Isoform 2 GST (N-Term) Protein [H00084701-P01]

SDS-PAGE: Recombinant Human COX IV Isoform 2 GST (N-Term) Protein [H00084701-P01]

SDS-Page: Recombinant Human COX IV Isoform 2 Protein [H00084701-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00084701-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: COX4-I2

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq]

Long Name

Cytochrome c Oxidase Subunit IV Isoform 2

Alternate Names

COX4-2, COX4B, COX4L2, COXIV-2

Gene Symbol

COX4I2

Additional COX4-I2 Products

Product Documents for Recombinant Human COX IV Isoform 2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human COX IV Isoform 2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human COX IV Isoform 2 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human COX IV Isoform 2 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human COX IV Isoform 2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes