COX15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59560

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COX15 Antibody - BSA Free

Western Blot: COX15 Antibody [NBP1-59560]

Western Blot: COX15 Antibody [NBP1-59560]

Western Blot: COX15 Antibody [NBP1-59560] - Lanes: Lane1 : 20 ug human fibroblast mitochondria Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: COX15.
Immunohistochemistry-Paraffin: COX15 Antibody [NBP1-59560]

Immunohistochemistry-Paraffin: COX15 Antibody [NBP1-59560]

Immunohistochemistry-Paraffin: COX15 Antibody [NBP1-59560] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: COX15 Antibody [NBP1-59560]

Western Blot: COX15 Antibody [NBP1-59560]

Western Blot: COX15 Antibody [NBP1-59560] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.

Applications for COX15 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COX15

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.

Alternate Names

COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5

Gene Symbol

COX15

Additional COX15 Products

Product Documents for COX15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COX15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COX15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COX15 Antibody - BSA Free and earn rewards!

Have you used COX15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...