CPS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54775

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Porcine

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CPS1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CPS1(carbamoyl-phosphate synthetase 1, mitochondrial) The peptide sequence was selected from the middle region of CPS1. Peptide sequence YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

165 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CPS1 Antibody - BSA Free

Western Blot: CPS1 Antibody [NBP1-54775]

Western Blot: CPS1 Antibody [NBP1-54775]

Western Blot: CPS1 Antibody [NBP1-54775] - Titration: 5.0ug/ml Positive Control: Human Fetal liver cell lysate.
Immunohistochemistry: CPS1 Antibody [NBP1-54775]

Immunohistochemistry: CPS1 Antibody [NBP1-54775]

Immunohistochemistry: CPS1 Antibody [NBP1-54775] - Pig ileum Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Brown: CPS Gene name: CPS1 Submitted by: Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine.
Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-54775]

Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-54775]

Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-54775] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
Immunohistochemistry: CPS1 Antibody [NBP1-54775]

Immunohistochemistry: CPS1 Antibody [NBP1-54775]

Immunohistochemistry: CPS1 Antibody [NBP1-54775] - Pig duodenum Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Brown: CPS Gene name: CPS1 Submitted by: Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine.
Immunohistochemistry: CPS1 Antibody [NBP1-54775]

Immunohistochemistry: CPS1 Antibody [NBP1-54775]

Immunohistochemistry: CPS1 Antibody [NBP1-54775] - Pig kidney Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution: 1 : 500. Color/Signal Descriptions: Brown: CPS Gene name: CPS1 Submitted by: Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine.

Applications for CPS1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPS1

Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.Carbamoyl phosphate synthetase I (EC 6.3.4.16) is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis (CAD; MIM 114010), which has been mapped to 2p21.[supplied by OMIM].

Alternate Names

carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16

Gene Symbol

CPS1

UniProt

P31327 (Human)

Additional CPS1 Products

Product Documents for CPS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CPS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPS1 Antibody - BSA Free and earn rewards!

Have you used CPS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies