Creatine Kinase, Muscle/CKMM Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52864

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the middle region of CKM. Peptide sequence GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Creatine Kinase, Muscle/CKMM Antibody - BSA Free

Western Blot: Creatine Kinase, Muscle/CKMM Antibody [NBP1-52864]

Western Blot: Creatine Kinase, Muscle/CKMM Antibody [NBP1-52864]

Western Blot: Creatine Kinase, Muscle/CKMM Antibody [NBP1-52864] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for Creatine Kinase, Muscle/CKMM Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Creatine Kinase, Muscle/CKMM

CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Creatine Kinase, Muscle

Alternate Names

CKM, CKMM, CKMMcreatine kinase M-type, Creatine Kinase Isoenzyme, Creatine kinase M chain, creatine kinase, muscle, creatine kinase-M, EC 2.7.3, EC 2.7.3.2, M-CK

Gene Symbol

CKM

UniProt

Additional Creatine Kinase, Muscle/CKMM Products

Product Documents for Creatine Kinase, Muscle/CKMM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Creatine Kinase, Muscle/CKMM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Creatine Kinase, Muscle/CKMM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Creatine Kinase, Muscle/CKMM Antibody - BSA Free and earn rewards!

Have you used Creatine Kinase, Muscle/CKMM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...