CREB3L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87208

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CREB3L2. Peptide sequence: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CREB3L2 Antibody - BSA Free

Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208] - Host: Rabbit. Target Name: CREB3L2. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: CREB3L2 Antibody [NBP2-87208]

Immunohistochemistry: CREB3L2 Antibody [NBP2-87208]

Immunohistochemistry: CREB3L2 Antibody [NBP2-87208] - Human kidney
Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208] - WB Suggested Anti-CREB3L2 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:12500. Positive Control: Jurkat cell lysate
Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208] - Host: Rabbit. Target Name: CREB3L2. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208]

Western Blot: CREB3L2 Antibody [NBP2-87208] - Host: Rabbit. Target Name: CREB3L2. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Applications for CREB3L2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CREB3L2

Alternate Names

basic transcription factor 2, BBF2 human homolog on chromosome 7, BBF2H7TCAG_1951439, B-ZIB transcription factor, cAMP responsive element binding protein 3-like 2, cAMP-responsive element-binding protein 3-like protein 2, cyclic AMP-responsive element-binding protein 3-like protein 2, FUS/BBF2H7 protein, MGC131709, MGC71006

Gene Symbol

CREB3L2

Additional CREB3L2 Products

Product Documents for CREB3L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CREB3L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CREB3L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CREB3L2 Antibody - BSA Free and earn rewards!

Have you used CREB3L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...