CRISPLD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84725

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CRISPLD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of CRISPLD1. Peptide sequence: YSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CRISPLD1 Antibody - BSA Free

Western Blot: CRISPLD1 Antibody [NBP2-84725]

Western Blot: CRISPLD1 Antibody [NBP2-84725]

Western Blot: CRISPLD1 Antibody [NBP2-84725] - WB Suggested Anti-CRISPLD1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver
Western Blot: CRISPLD1 Antibody [NBP2-84725]

Western Blot: CRISPLD1 Antibody [NBP2-84725]

Western Blot: CRISPLD1 Antibody [NBP2-84725] - Host: Rabbit. Target: CRISPLD1. Positive control (+): Human Liver (LI). Negative control (-): HepG2 Cell Lysate (HG). Antibody concentration: 1ug/ml

Applications for CRISPLD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRISPLD1

Alternate Names

CocoaCrisp, CRISP10, CRISP-10, Cysteine-rich secretory protein 10, cysteine-rich secretory protein LCCL domain containing 1, cysteine-rich secretory protein LCCL domain-containing 1, DKFZp762F133, LCCL domain containing cysteine-rich secretory protein 1, LCCL domain-containing cysteine-rich secretory protein 1, LCRISP1, Trypsin inhibitor Hl

Gene Symbol

CRISPLD1

Additional CRISPLD1 Products

Product Documents for CRISPLD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRISPLD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRISPLD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRISPLD1 Antibody - BSA Free and earn rewards!

Have you used CRISPLD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies