CRLR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58137

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CRLR Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL

Reactivity Notes

Mouse (86%), Rat (86%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CRLR Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CRLR Antibody [NBP2-58137]

Immunocytochemistry/ Immunofluorescence: CRLR Antibody [NBP2-58137]

Immunocytochemistry/Immunofluorescence: CALCRL Antibody [NBP2-58137] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Applications for CRLR Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRLR

Calcitonin receptor-like receptor (CRLR) is an Adrenomedullin Receptor that requires two additional proteins to function: a chaperone protein RAMP (receptor activity modifying protein) and the component protein RCP. The function of CRLR depends on its interaction with RAMP. When coexpressed with RAMP1, CRLR acts as a receptor for calcitonin gene-related peptide (CGRP). In contrast, when CRLR is coexpressed with either RAMP2 or RAMP3, it acts as a receptor for adrenomedullin. Activation of the receptor leads to an increase in intracellular cyclic AMP. CRLR mediates the vasorelaxation of arteries, suggesting a potential role for the receptor in reaction to injury, particularly in the treatment of pulmonary hypertension. CRLR expression has been reported in brain, lung, blood vessel, liver, and intestinal tract. ESTs have been isolated from B-Cell/lung/testis, bone marrow, embryo, lung, and synovium libraries.

Long Name

Calcitonin Receptor-like Receptor

Alternate Names

CALCRL, CGRPR

Gene Symbol

CALCRL

Additional CRLR Products

Product Documents for CRLR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRLR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRLR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRLR Antibody - BSA Free and earn rewards!

Have you used CRLR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies