CRYBA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87215

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CRYBA4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRYBA4. Peptide sequence: RGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CRYBA4 Antibody - BSA Free

Western Blot: CRYBA4 Antibody [NBP2-87215]

Western Blot: CRYBA4 Antibody [NBP2-87215]

Western Blot: CRYBA4 Antibody [NBP2-87215] - WB Suggested Anti-CRYBA4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 293T cell lysate

Applications for CRYBA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRYBA4

CRYBA4, or Beta-crystallin A4, consists of a 196 amino acid isoform that is 22 kDa, and is involved in maintaining the structure, transparency, and refractive index of the eye lens. Current disease research has linked defects in CRYBA4 to several types of cataracts, including lamellar 2 cataracts, zonular cataract, congenital cataracts, and microphthalmia cataract. Researchers are also studying the relation between the protein and the disorders choroididits and neurofibromatosis. CRYBA4 is included in several biological processes, including visual perception and camera-type eye development, through which it interacts with CRYBB2 and CRYBB3.

Alternate Names

Beta-A4 crystallin, beta-crystallin A4, crystallin, beta A4, crystallin, beta polypeptide A4, eye lens structural protein, MCOPCT4

Gene Symbol

CRYBA4

Additional CRYBA4 Products

Product Documents for CRYBA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRYBA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRYBA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRYBA4 Antibody - BSA Free and earn rewards!

Have you used CRYBA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies