CRYZL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89364

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 22042635)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CRYZL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364]

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364]

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364] - Staining of human gastrointestinal shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364]

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364]

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364] - Staining of human cerebral cortex shows very strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364]

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364]

Immunohistochemistry-Paraffin: CRYZL1 Antibody [NBP1-89364] - Staining of human testis shows very strong cytoplasmic positivity in cells in seminiferous ducts.
CRYZL1 Antibody - BSA Free Western Blot: CRYZL1 Antibody - BSA Free [NBP1-89364]

Western Blot: CRYZL1 Antibody - BSA Free [NBP1-89364]

Analysis in control (vector only transfected HEK293T lysate) and CRYZL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for CRYZL1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRYZL1

CRYZL1, also known as Quinone oxidoreductase-like protein 1, is a 349 amino acid 38.6 kDa protein that is involved with NAD(P)H binding and is ubiquitously expressed in tissue samples. The protein is involved with the Oxidation-reduction and quinone cofactor metabolic pathways. This protein is still undergoing additional classification and the Isoform 2 sequence has not yet been determined.

Alternate Names

crystallin, zeta (quinone reductase)-like 1, human quinone oxidoreductase homolog-1104P11QOH-1quinone oxidoreductase-like protein 1, Protein 4P11, Quinone oxidoreductase homolog 1, quinone reductase-like 1, Zeta-crystallin homolog

Gene Symbol

CRYZL1

Additional CRYZL1 Products

Product Documents for CRYZL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRYZL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CRYZL1 Antibody - BSA Free

Customer Reviews for CRYZL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRYZL1 Antibody - BSA Free and earn rewards!

Have you used CRYZL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...