CST9L Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10654

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST9L. Peptide sequence ILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRLGH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CST9L Antibody - BSA Free

Western Blot: CST9L Antibody [NBP3-10654]

Western Blot: CST9L Antibody [NBP3-10654]

Western Blot: CST9L Antibody [NBP3-10654] - Western blot analysis of CST9L in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for CST9L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CST9L

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members areactive cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. Thereare three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and thekininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of humanfluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes andpseudogenes. This gene is located in the cystatin locus and encodes a protein similar to mouse cystatin 9. Based onits testis-specific expression, it is likely to have a role in tissue reorganization during early testis development.(provided by RefSeq)

Alternate Names

bA218C14.1, cystatin 9 (mouse)-like, cystatin 9-like, cystatin-9-like, FLJ92394, testatin

Gene Symbol

CST9L

Additional CST9L Products

Product Documents for CST9L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CST9L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CST9L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CST9L Antibody - BSA Free and earn rewards!

Have you used CST9L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...